Lineage for d1kx5f_ (1kx5 F:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353235Protein Histone H4 [47125] (4 species)
  7. 353236Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries)
  8. 353250Domain d1kx5f_: 1kx5 F: [77598]
    Other proteins in same PDB: d1kx5a_, d1kx5c_, d1kx5d_, d1kx5e_, d1kx5g_, d1kx5h_
    complexed with cl, mn

Details for d1kx5f_

PDB Entry: 1kx5 (more details), 1.94 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution

SCOP Domain Sequences for d1kx5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx5f_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis)}
sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1kx5f_:

Click to download the PDB-style file with coordinates for d1kx5f_.
(The format of our PDB-style files is described here.)

Timeline for d1kx5f_: