Class a: All alpha proteins [46456] (179 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) |
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (4 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (7 PDB entries) |
Domain d1kx5f_: 1kx5 F: [77598] Other proteins in same PDB: d1kx5a_, d1kx5c_, d1kx5d_, d1kx5e_, d1kx5g_, d1kx5h_ complexed with cl, mn |
PDB Entry: 1kx5 (more details), 1.94 Å
SCOP Domain Sequences for d1kx5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx5f_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis)} sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
Timeline for d1kx5f_: