Lineage for d1kx5a_ (1kx5 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482793Protein Histone H3 [47122] (6 species)
  7. 1482794Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1482795Domain d1kx5a_: 1kx5 A: [77593]
    Other proteins in same PDB: d1kx5b_, d1kx5c_, d1kx5d_, d1kx5f_, d1kx5g_, d1kx5h_
    protein/DNA complex; complexed with cl, mn

Details for d1kx5a_

PDB Entry: 1kx5 (more details), 1.94 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d1kx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx5a_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
pkdiqlarrirgera

SCOPe Domain Coordinates for d1kx5a_:

Click to download the PDB-style file with coordinates for d1kx5a_.
(The format of our PDB-style files is described here.)

Timeline for d1kx5a_: