SCOP 1.65: Domain d1kx4b_: 1kx4 B:

Lineage for d1kx4b_ (1kx4 B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (7 PDB entries)

8. Domain d1kx4b_: 1kx4 B: [77586]
   Other proteins in same PDB: d1kx4a_, d1kx4c_, d1kx4d_, d1kx4e_, d1kx4g_, d1kx4h_

Details for d1kx4b_

PDB Entry: 1kx4, 2.6 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution

SCOP Domain Sequences for d1kx4b_:

Sequence; same for both SEQRES and ATOM records:

>d1kx4b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

Timeline for d1kx4b_:

• d1kx4b_ first appeared in SCOP 1.63
  
• d1kx4b_ appears in SCOP 1.67
  
• d1kx4b_ appears in the current release, SCOPe 2.08