SCOP 1.67: Domain d1kx3d_: 1kx3 D:

Lineage for d1kx3d_ (1kx3 D:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)

8. Domain d1kx3d_: 1kx3 D: [77580]
   Other proteins in same PDB: d1kx3a_, d1kx3b_, d1kx3c_, d1kx3e_, d1kx3f_, d1kx3g_

Details for d1kx3d_

PDB Entry: 1kx3, 2 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution

SCOP Domain Sequences for d1kx3d_:

Sequence; same for both SEQRES and ATOM records:

>d1kx3d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1kx3d_:

• d1kx3d_ first appeared in SCOP 1.63
  
• d1kx3d_ appears in SCOP 1.65
  
• d1kx3d_ appears in SCOP 1.69
  
• d1kx3d_ appears in the current release, SCOPe 2.08