Class a: All alpha proteins [46456] (226 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (4 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries) |
Domain d1kx3b_: 1kx3 B: [77578] Other proteins in same PDB: d1kx3a_, d1kx3c_, d1kx3d_, d1kx3e_, d1kx3g_, d1kx3h_ |
PDB Entry: 1kx3 (more details), 2 Å
SCOP Domain Sequences for d1kx3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx3b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)} vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt vtamdvvyalkrqgrtlygfgg
Timeline for d1kx3b_: