Lineage for d1kwoa2 (1kwo A:5-28,A:77-835)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243546Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 243577Protein Myosin S1, motor domain [52642] (4 species)
    common fold is interrupted with some all-alpha subdomains
  7. 243578Species Bay scallop (Aequipecten irradians) [TaxId:31199] [52644] (8 PDB entries)
  8. 243584Domain d1kwoa2: 1kwo A:5-28,A:77-835 [77570]
    Other proteins in same PDB: d1kwoa1, d1kwob_, d1kwoc_
    complexed with ags, ca, mg, pdm

Details for d1kwoa2

PDB Entry: 1kwo (more details), 3.8 Å

PDB Description: scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation
PDB Compounds: (A:)

SCOP Domain Sequences for d1kwoa2:

Sequence, based on SEQRES records: (download)

>d1kwoa2 c.37.1.9 (A:5-28,A:77-835) Myosin S1, motor domain {Bay scallop (Aequipecten irradians)}
fsdpdfqylavdrkklmkeqtaafXmnppkfekledmanmtylneasvlynlrsrytsgl
iytysglfciavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqs
clitgesgagktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygn
akttrnnnssrfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsn
aipelndvmlvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkc
tasilhmgemkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvt
kgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfns
feqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgils
ileeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysi
tgwleknkdpinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhre
slnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrl
iysefkqrysilapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnle
emrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklys
kvkp

Sequence, based on observed residues (ATOM records): (download)

>d1kwoa2 c.37.1.9 (A:5-28,A:77-835) Myosin S1, motor domain {Bay scallop (Aequipecten irradians)}
fsdpdfqylavdrkklmkeafXmnppkfekledmanmtylneasvlynlrsrytsgliyt
ysglfciavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqscli
tgesgagktentkkvimylakvacavkkegsledqiiqanpvleaygnakttrnnnssrf
gkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvt
pdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkf
kqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgvtkgqnmnqvvnsvgal
akslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqq
ffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddks
fqdklyqnhmgknrmftrpnqgpahfelhhyagnvpysitgwleknkdpinenvvallga
skeplvaelfkafqtisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlh
qlqcngvlrkgfpsrliysefkqrysilapndgktvsekilaglqmdpaeyrlgttkvff
kagvlgnleemrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlr
nwqwwklyskvkp

SCOP Domain Coordinates for d1kwoa2:

Click to download the PDB-style file with coordinates for d1kwoa2.
(The format of our PDB-style files is described here.)

Timeline for d1kwoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kwoa1