SCOPe 2.06: Domain d1kwka3: 1kwk A:394-590

Lineage for d1kwka3 (1kwk A:394-590)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.5: A4 beta-galactosidase middle domain [82351] (1 protein)
   probable non-catalytic branch of the class I GAT family; overall fold is very similar but the active site is not conserved
   automatically mapped to Pfam PF08532

6. Protein A4 beta-galactosidase middle domain [82352] (1 species)

7. Species Thermus thermophilus [TaxId:274] [82353] (2 PDB entries)

8. Domain d1kwka3: 1kwk A:394-590 [77567]
   Other proteins in same PDB: d1kwka1, d1kwka2
   complexed with act, cl, gal, mpd, zn

Details for d1kwka3

PDB Entry: 1kwk, 2.2 Å

PDB Description: crystal structure of thermus thermophilus a4 beta-galactosidase in complex with galactose

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1kwka3:

Sequence; same for both SEQRES and ATOM records:

>d1kwka3 c.23.16.5 (A:394-590) A4 beta-galactosidase middle domain {Thermus thermophilus [TaxId: 274]}
pvaqapvalvfdyeaawiyevqpqgaewsylglvylfysalrrlgldvdvvppgaslrgy
afavvpslpivreealeafreaegpvlfgprsgsktetfqipkelppgplqallplkvvr
veslppgllevaegalgrfplglwrewveaplkplltfqdgkgalyregrylylaawpsp
elagrllsalaaeaglk

Timeline for d1kwka3:

• d1kwka3 first appeared in SCOP 1.63
  
• d1kwka3 appears in SCOPe 2.05
  
• d1kwka3 appears in SCOPe 2.07
  
• d1kwka3 appears in the current release, SCOPe 2.08