SCOPe 2.05: Domain d1kwga2: 1kwg A:1-393

Lineage for d1kwga2 (1kwg A:1-393)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein A4 beta-galactosidase [82246] (1 species)
   the catalytic domain is very similar to that of the bacterial beta-amylase; but contains a typical alpha-amylase extra domain

7. Species Thermus thermophilus [TaxId:274] [82247] (2 PDB entries)

8. Domain d1kwga2: 1kwg A:1-393 [77562]
   Other proteins in same PDB: d1kwga1, d1kwga3
   complexed with act, cl, mpd, zn

Details for d1kwga2

PDB Entry: 1kwg, 1.6 Å

PDB Description: Crystal structure of Thermus thermophilus A4 beta-galactosidase

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1kwga2:

Sequence; same for both SEQRES and ATOM records:

>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]}
mlgvcyypehwpkerwkedarrmreaglshvrigefawallepepgrlewgwldeaiatl
aaeglkvvlgtptatppkwlvdrypeilpvdregrrrrfggrrhycfsspvyreearriv
tllaeryggleavagfqtdneygchdtvrcycprcqeafrgwlearygtiealneawgta
fwsqryrsfaevelphltvaepnpshlldyyrfasdqvrafnrlqveilrahapgkfvth
nfmgfftdldafalaqdldfaswdsyplgftdlmplppeeklryartghpdvaafhhdly
rgvgrgrfwvmeqqpgpvnwaphnpspapgmvrlwtwealahgaevvsyfrwrqapfaqe
qmhaglhrpdsapdqgffeakrvaeelaalalp

Timeline for d1kwga2:

• d1kwga2 first appeared in SCOP 1.63
  
• d1kwga2 appears in SCOPe 2.04
  
• d1kwga2 appears in SCOPe 2.06
  
• d1kwga2 appears in the current release, SCOPe 2.08