Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein A4 beta-galactosidase [82246] (1 species) the catalytic domain is very similar to that of the bacterial beta-amylase; but contains a typical alpha-amylase extra domain |
Species Thermus thermophilus [TaxId:274] [82247] (2 PDB entries) |
Domain d1kwga2: 1kwg A:1-393 [77562] Other proteins in same PDB: d1kwga1, d1kwga3 complexed with act, cl, mpd, zn |
PDB Entry: 1kwg (more details), 1.6 Å
SCOPe Domain Sequences for d1kwga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} mlgvcyypehwpkerwkedarrmreaglshvrigefawallepepgrlewgwldeaiatl aaeglkvvlgtptatppkwlvdrypeilpvdregrrrrfggrrhycfsspvyreearriv tllaeryggleavagfqtdneygchdtvrcycprcqeafrgwlearygtiealneawgta fwsqryrsfaevelphltvaepnpshlldyyrfasdqvrafnrlqveilrahapgkfvth nfmgfftdldafalaqdldfaswdsyplgftdlmplppeeklryartghpdvaafhhdly rgvgrgrfwvmeqqpgpvnwaphnpspapgmvrlwtwealahgaevvsyfrwrqapfaqe qmhaglhrpdsapdqgffeakrvaeelaalalp
Timeline for d1kwga2: