Lineage for d1kwga1 (1kwg A:591-644)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2419814Protein A4 beta-galactosidase [82181] (1 species)
    the catalytic domain of this protein is similar to that of the bacterial beta-amylase
  7. 2419815Species Thermus thermophilus [TaxId:274] [82182] (2 PDB entries)
  8. 2419816Domain d1kwga1: 1kwg A:591-644 [77561]
    Other proteins in same PDB: d1kwga2, d1kwga3
    complexed with act, cl, mpd, zn

Details for d1kwga1

PDB Entry: 1kwg (more details), 1.6 Å

PDB Description: Crystal structure of Thermus thermophilus A4 beta-galactosidase
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1kwga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwga1 b.71.1.1 (A:591-644) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]}
vlslpeglrlrrrgtwvfafnygpeaveapasegarfllgsrrvgpydlavwee

SCOPe Domain Coordinates for d1kwga1:

Click to download the PDB-style file with coordinates for d1kwga1.
(The format of our PDB-style files is described here.)

Timeline for d1kwga1: