Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein A4 beta-galactosidase [82181] (1 species) the catalytic domain of this protein is similar to that of the bacterial beta-amylase |
Species Thermus thermophilus [TaxId:274] [82182] (2 PDB entries) |
Domain d1kwga1: 1kwg A:591-644 [77561] Other proteins in same PDB: d1kwga2, d1kwga3 complexed with act, cl, mpd, zn |
PDB Entry: 1kwg (more details), 1.6 Å
SCOPe Domain Sequences for d1kwga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwga1 b.71.1.1 (A:591-644) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} vlslpeglrlrrrgtwvfafnygpeaveapasegarfllgsrrvgpydlavwee
Timeline for d1kwga1: