SCOP 1.69: Domain d1kwcb2: 1kwc B:133-288

Lineage for d1kwcb2 (1kwc B:133-288)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)

7. Species Pseudomonas sp. [TaxId:306] [54604] (10 PDB entries)

8. Domain d1kwcb2: 1kwc B:133-288 [77560]

Details for d1kwcb2

PDB Entry: 1kwc, 2.1 Å

PDB Description: the his145ala mutant of 2,3-dihydroxybiphenyl dioxygenase in complex with 2,3-dihydroxybiphenyl

SCOP Domain Sequences for d1kwcb2:

Sequence; same for both SEQRES and ATOM records:

>d1kwcb2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp.}
vsgfvtgdqgigafvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr
hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt
pspmievefgwgprtvdsswtvarhsrtamwghksv

Timeline for d1kwcb2:

• d1kwcb2 first appeared in SCOP 1.63
  
• d1kwcb2 appears in SCOP 1.67
  
• d1kwcb2 appears in SCOP 1.71
  
• d1kwcb2 appears in the current release, SCOPe 2.08