Lineage for d1kwbb1 (1kwb B:1-132)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327552Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 327553Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 327617Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 327618Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 327632Species Pseudomonas sp. [TaxId:306] [54604] (10 PDB entries)
  8. 327641Domain d1kwbb1: 1kwb B:1-132 [77557]

Details for d1kwbb1

PDB Entry: 1kwb (more details), 2 Å

PDB Description: crystal structure of the his145ala mutant of 2,3-dihydroxybipheny dioxygenase (bphc)

SCOP Domain Sequences for d1kwbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwbb1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp.}
sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
eifhepflpsap

SCOP Domain Coordinates for d1kwbb1:

Click to download the PDB-style file with coordinates for d1kwbb1.
(The format of our PDB-style files is described here.)

Timeline for d1kwbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kwbb2