SCOPe 2.06: Domain d1kw9b1: 1kw9 B:1-132

Lineage for d1kw9b1 (1kw9 B:1-132)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)

7. Species Pseudomonas sp. [TaxId:306] [54604] (11 PDB entries)

8. Domain d1kw9b1: 1kw9 B:1-132 [77555]
   complexed with bpy, fe2

Details for d1kw9b1

PDB Entry: 1kw9, 1.95 Å

PDB Description: Crystal structure of 2,3-dihydroxybiphenyl dioxygenase (BphC) in complex with 2,3-dihydroxybiphenyl at 2.0A resolution

PDB Compounds: (B:) 2,3-Dihydroxybiphenyl dioxygenase

SCOPe Domain Sequences for d1kw9b1:

Sequence; same for both SEQRES and ATOM records:

>d1kw9b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]}
sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
eifhepflpsap

Timeline for d1kw9b1:

• d1kw9b1 first appeared in SCOP 1.63
  
• d1kw9b1 appears in SCOPe 2.05
  
• d1kw9b1 appears in SCOPe 2.07
  
• d1kw9b1 appears in the current release, SCOPe 2.08