Lineage for d1kw8b2 (1kw8 B:133-288)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 502239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) (S)
  5. 502320Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 502321Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)
  7. 502335Species Pseudomonas sp. [TaxId:306] [54604] (10 PDB entries)
  8. 502351Domain d1kw8b2: 1kw8 B:133-288 [77554]

Details for d1kw8b2

PDB Entry: 1kw8 (more details), 2 Å

PDB Description: Crystal structure of BphC-2,3-dihydroxybiphenyl-NO complex

SCOP Domain Sequences for d1kw8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kw8b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp.}
vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr
hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt
pspmievefgwgprtvdsswtvarhsrtamwghksv

SCOP Domain Coordinates for d1kw8b2:

Click to download the PDB-style file with coordinates for d1kw8b2.
(The format of our PDB-style files is described here.)

Timeline for d1kw8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kw8b1