Lineage for d1kv6a_ (1kv6 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747388Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 1747389Species Human (Homo sapiens) [TaxId:9606] [81917] (14 PDB entries)
    Uniprot O75454 233-458
  8. 1747420Domain d1kv6a_: 1kv6 A: [77546]
    complexed with a co-activator peptide

Details for d1kv6a_

PDB Entry: 1kv6 (more details), 2.7 Å

PDB Description: X-ray structure of the orphan nuclear receptor ERR3 ligand-binding domain in the constitutively active conformation
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d1kv6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv6a_ a.123.1.1 (A:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea

SCOPe Domain Coordinates for d1kv6a_:

Click to download the PDB-style file with coordinates for d1kv6a_.
(The format of our PDB-style files is described here.)

Timeline for d1kv6a_: