SCOPe 2.06: Domain d1ktma_: 1ktm A:

Lineage for d1ktma_ (1ktm A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families)

5. Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
   automatically mapped to Pfam PF03623

6. Protein FAT domain of focal adhesion kinase [68995] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81735] (3 PDB entries)
   Uniprot Q00944 RE 920-1053

8. Domain d1ktma_: 1ktm A: [77541]

Details for d1ktma_

PDB Entry: 1ktm

PDB Description: solution structure of fat domain of focal adhesion kinase

PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1ktma_:

Sequence; same for both SEQRES and ATOM records:

>d1ktma_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Chicken (Gallus gallus) [TaxId: 9031]}
manldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslp
vlpasthreiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdakn
lldvidqarlkmisqsrph

Timeline for d1ktma_:

• d1ktma_ first appeared in SCOP 1.63
  
• d1ktma_ appears in SCOPe 2.05
  
• d1ktma_ appears in SCOPe 2.07
  
• d1ktma_ appears in the current release, SCOPe 2.08