Lineage for d1ktma_ (1ktm A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279291Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 279548Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (1 family) (S)
  5. 279549Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (1 protein)
  6. 279550Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 279551Species Chicken (Gallus gallus) [TaxId:9031] [81735] (1 PDB entry)
  8. 279552Domain d1ktma_: 1ktm A: [77541]

Details for d1ktma_

PDB Entry: 1ktm (more details)

PDB Description: solution structure of fat domain of focal adhesion kinase

SCOP Domain Sequences for d1ktma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktma_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Chicken (Gallus gallus)}
manldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslp
vlpasthreiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdakn
lldvidqarlkmisqsrph

SCOP Domain Coordinates for d1ktma_:

Click to download the PDB-style file with coordinates for d1ktma_.
(The format of our PDB-style files is described here.)

Timeline for d1ktma_: