Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries) |
Domain d1ktlc2: 1ktl C:1-181 [77539] Other proteins in same PDB: d1ktla1, d1ktlb_, d1ktlc1, d1ktld_ complexed with so4 |
PDB Entry: 1ktl (more details), 3.1 Å
SCOPe Domain Sequences for d1ktlc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktlc2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]} gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll h
Timeline for d1ktlc2:
View in 3D Domains from other chains: (mouse over for more information) d1ktla1, d1ktla2, d1ktlb_, d1ktld_ |