Lineage for d1ktlc2 (1ktl C:1-181)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409372Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)
  7. 409471Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (3 PDB entries)
  8. 409477Domain d1ktlc2: 1ktl C:1-181 [77539]
    Other proteins in same PDB: d1ktla1, d1ktlb_, d1ktlc1, d1ktld_
    complexed with so4; mutant

Details for d1ktlc2

PDB Entry: 1ktl (more details), 3.1 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E

SCOP Domain Sequences for d1ktlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktlc2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

SCOP Domain Coordinates for d1ktlc2:

Click to download the PDB-style file with coordinates for d1ktlc2.
(The format of our PDB-style files is described here.)

Timeline for d1ktlc2: