SCOP 1.63: Domain d1ktlc2: 1ktl C:1-181

Lineage for d1ktlc2 (1ktl C:1-181)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (3 PDB entries)

8. Domain d1ktlc2: 1ktl C:1-181 [77539]
   Other proteins in same PDB: d1ktla1, d1ktlb_, d1ktlc1, d1ktld_
   complexed with so4; mutant

Details for d1ktlc2

PDB Entry: 1ktl, 3.1 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e

SCOP Domain Sequences for d1ktlc2:

Sequence; same for both SEQRES and ATOM records:

>d1ktlc2 d.19.1.1 (C:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

Timeline for d1ktlc2:

• d1ktlc2 is new in SCOP 1.63
  
• d1ktlc2 appears in SCOP 1.65
  
• d1ktlc2 appears in the current release, SCOPe 2.08