SCOPe 2.02: Domain d1ktlc1: 1ktl C:182-274

Lineage for d1ktlc1 (1ktl C:182-274)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d1ktlc1: 1ktl C:182-274 [77538]
   Other proteins in same PDB: d1ktla2, d1ktlb_, d1ktlc2, d1ktld_
   complexed with so4

Details for d1ktlc1

PDB Entry: 1ktl, 3.1 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e

PDB Compounds: (C:) hla class I histocompatibility antigen, alpha chain

SCOPe Domain Sequences for d1ktlc1:

Sequence; same for both SEQRES and ATOM records:

>d1ktlc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqaytchvqheglpepvtlrw

Timeline for d1ktlc1:

• d1ktlc1 first appeared in SCOP 1.63
  
• d1ktlc1 appears in SCOPe 2.01
  
• d1ktlc1 appears in SCOPe 2.03
  
• d1ktlc1 appears in the current release, SCOPe 2.08