Lineage for d1ktlc1 (1ktl C:182-274)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220582Species Human (Homo sapiens), HLA-E [TaxId:9606] [48957] (3 PDB entries)
  8. 220593Domain d1ktlc1: 1ktl C:182-274 [77538]
    Other proteins in same PDB: d1ktla2, d1ktlc2
    complexed with so4; mutant

Details for d1ktlc1

PDB Entry: 1ktl (more details), 3.1 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e

SCOP Domain Sequences for d1ktlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktlc1 b.1.1.2 (C:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-E}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqaytchvqheglpepvtlrw

SCOP Domain Coordinates for d1ktlc1:

Click to download the PDB-style file with coordinates for d1ktlc1.
(The format of our PDB-style files is described here.)

Timeline for d1ktlc1: