SCOP 1.73: Domain d1ktla2: 1ktl A:1-181

Lineage for d1ktla2 (1ktl A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (4 PDB entries)

8. Domain d1ktla2: 1ktl A:1-181 [77536]
   Other proteins in same PDB: d1ktla1, d1ktlb_, d1ktlc1, d1ktld_

Details for d1ktla2

PDB Entry: 1ktl, 3.1 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e

PDB Compounds: (A:) hla class I histocompatibility antigen, alpha chain

SCOP Domain Sequences for d1ktla2:

Sequence; same for both SEQRES and ATOM records:

>d1ktla2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

Timeline for d1ktla2:

• d1ktla2 first appeared in SCOP 1.63
  
• d1ktla2 appears in SCOP 1.71
  
• d1ktla2 appears in SCOP 1.75
  
• d1ktla2 appears in the current release, SCOPe 2.08