Lineage for d1ktla2 (1ktl A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600370Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (3 PDB entries)
  8. 600375Domain d1ktla2: 1ktl A:1-181 [77536]
    Other proteins in same PDB: d1ktla1, d1ktlb_, d1ktlc1, d1ktld_

Details for d1ktla2

PDB Entry: 1ktl (more details), 3.1 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E

SCOP Domain Sequences for d1ktla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktla2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

SCOP Domain Coordinates for d1ktla2:

Click to download the PDB-style file with coordinates for d1ktla2.
(The format of our PDB-style files is described here.)

Timeline for d1ktla2: