Lineage for d1ktla2 (1ktl A:1-181)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163098Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2163382Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)
  8. 2163394Domain d1ktla2: 1ktl A:1-181 [77536]
    Other proteins in same PDB: d1ktla1, d1ktlb1, d1ktlb2, d1ktlc1, d1ktld1, d1ktld2
    complexed with so4

Details for d1ktla2

PDB Entry: 1ktl (more details), 3.1 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E
PDB Compounds: (A:) hla class I histocompatibility antigen, alpha chain

SCOPe Domain Sequences for d1ktla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktla2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

SCOPe Domain Coordinates for d1ktla2:

Click to download the PDB-style file with coordinates for d1ktla2.
(The format of our PDB-style files is described here.)

Timeline for d1ktla2: