SCOPe 2.01: Domain d1kt8b_: 1kt8 B:

Lineage for d1kt8b_ (1kt8 B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)

6. Protein Branched-chain aminoacid aminotransferase [56757] (2 species)

7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [64508] (9 PDB entries)

8. Domain d1kt8b_: 1kt8 B: [77532]
   complexed with acy, gol, ilp

Details for d1kt8b_

PDB Entry: 1kt8, 1.9 Å

PDB Description: human branched chain amino acid aminotransferase (mitochondrial): three dimensional structure of enzyme in its ketimine form with the substrate l-isoleucine

PDB Compounds: (B:) branched-chain amino acid aminotransferase, mitochondrial

SCOPe Domain Sequences for d1kt8b_:

Sequence; same for both SEQRES and ATOM records:

>d1kt8b_ e.17.1.1 (B:) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
wmfpv

Timeline for d1kt8b_:

• d1kt8b_ first appeared in SCOP 1.63
  
• d1kt8b_ appears in SCOP 1.75
  
• d1kt8b_ appears in SCOPe 2.02
  
• d1kt8b_ appears in the current release, SCOPe 2.08