SCOPe 2.06: Domain d1kt1a1: 1kt1 A:254-421

Lineage for d1kt1a1 (1kt1 A:254-421)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein FKBP51, C-terminal domain [81905] (2 species)

7. Species Monkey (Saimiri boliviensis) [TaxId:27679] [81907] (1 PDB entry)

8. Domain d1kt1a1: 1kt1 A:254-421 [77528]
   Other proteins in same PDB: d1kt1a2, d1kt1a3
   complexed with so4

Details for d1kt1a1

PDB Entry: 1kt1, 2.8 Å

PDB Description: Structure of the Large FKBP-like Protein, FKBP51, Involved in Steroid Receptor Complexes

PDB Compounds: (A:) FK506-binding protein FKBP51

SCOPe Domain Sequences for d1kt1a1:

Sequence; same for both SEQRES and ATOM records:

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}
keswemdtkekleqaaivkekgtvyfkggkyvqaviqygkivswlemeyglsekeskase
sfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakgd
fekvlevnpqnkaarlqifmcqkkakehnerdrrtyanmfkkfaeqda

Timeline for d1kt1a1:

• d1kt1a1 first appeared in SCOP 1.63
  
• d1kt1a1 appears in SCOPe 2.05
  
• d1kt1a1 appears in SCOPe 2.07
  
• d1kt1a1 appears in the current release, SCOPe 2.08