![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein FKBP51, C-terminal domain [81905] (2 species) |
![]() | Species Monkey (Saimiri boliviensis) [TaxId:27679] [81907] (1 PDB entry) |
![]() | Domain d1kt1a1: 1kt1 A:254-421 [77528] Other proteins in same PDB: d1kt1a2, d1kt1a3 complexed with so4 |
PDB Entry: 1kt1 (more details), 2.8 Å
SCOPe Domain Sequences for d1kt1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} keswemdtkekleqaaivkekgtvyfkggkyvqaviqygkivswlemeyglsekeskase sfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakgd fekvlevnpqnkaarlqifmcqkkakehnerdrrtyanmfkkfaeqda
Timeline for d1kt1a1: