Lineage for d1kt1a1 (1kt1 A:254-421)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 217224Superfamily a.118.8: TPR-like [48452] (2 families) (S)
  5. 217225Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (8 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 217230Protein FKBP51, C-terminal domain [81905] (2 species)
  7. 217233Species Monkey (Saimiri boliviensis) [TaxId:27679] [81907] (1 PDB entry)
  8. 217234Domain d1kt1a1: 1kt1 A:254-421 [77528]
    Other proteins in same PDB: d1kt1a2, d1kt1a3
    complexed with so4

Details for d1kt1a1

PDB Entry: 1kt1 (more details), 2.8 Å

PDB Description: Structure of the Large FKBP-like Protein, FKBP51, Involved in Steroid Receptor Complexes

SCOP Domain Sequences for d1kt1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis)}
keswemdtkekleqaaivkekgtvyfkggkyvqaviqygkivswlemeyglsekeskase
sfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakgd
fekvlevnpqnkaarlqifmcqkkakehnerdrrtyanmfkkfaeqda

SCOP Domain Coordinates for d1kt1a1:

Click to download the PDB-style file with coordinates for d1kt1a1.
(The format of our PDB-style files is described here.)

Timeline for d1kt1a1: