Lineage for d1kt0a1 (1kt0 A:254-412)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501447Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1501448Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1501453Protein FKBP51, C-terminal domain [81905] (2 species)
  7. 1501454Species Human (Homo sapiens) [TaxId:9606] [81906] (1 PDB entry)
  8. 1501455Domain d1kt0a1: 1kt0 A:254-412 [77525]
    Other proteins in same PDB: d1kt0a2, d1kt0a3
    complexed with so4

Details for d1kt0a1

PDB Entry: 1kt0 (more details), 2.7 Å

PDB Description: structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
PDB Compounds: (A:) 51 kda fk506-binding protein

SCOPe Domain Sequences for d1kt0a1:

Sequence, based on SEQRES records: (download)

>d1kt0a1 a.118.8.1 (A:254-412) FKBP51, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
keswemdtkekleqaaivkekgtvyfkggkymqaviqygkivswlemeyglsekeskase
sfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakgd
fekvlevnpqnkaarlqismcqkkakehnerdrriyanm

Sequence, based on observed residues (ATOM records): (download)

>d1kt0a1 a.118.8.1 (A:254-412) FKBP51, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
keswemdtkekleqaaivkekgtvyfkggkymqaviqygkivswlemeyglsekeskase
sfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakgd
fekvlevnaarlqismcqkkakehnerdrriyanm

SCOPe Domain Coordinates for d1kt0a1:

Click to download the PDB-style file with coordinates for d1kt0a1.
(The format of our PDB-style files is described here.)

Timeline for d1kt0a1: