Lineage for d1kt0a1 (1kt0 A:254-412)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 217224Superfamily a.118.8: TPR-like [48452] (2 families) (S)
  5. 217225Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (8 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 217230Protein FKBP51, C-terminal domain [81905] (2 species)
  7. 217231Species Human (Homo sapiens) [TaxId:9606] [81906] (1 PDB entry)
  8. 217232Domain d1kt0a1: 1kt0 A:254-412 [77525]
    Other proteins in same PDB: d1kt0a2, d1kt0a3
    complexed with so4; mutant

Details for d1kt0a1

PDB Entry: 1kt0 (more details), 2.7 Å

PDB Description: structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes

SCOP Domain Sequences for d1kt0a1:

Sequence, based on SEQRES records: (download)

>d1kt0a1 a.118.8.1 (A:254-412) FKBP51, C-terminal domain {Human (Homo sapiens)}
keswemdtkekleqaaivkekgtvyfkggkymqaviqygkivswlemeyglsekeskase
sfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakgd
fekvlevnpqnkaarlqismcqkkakehnerdrriyanm

Sequence, based on observed residues (ATOM records): (download)

>d1kt0a1 a.118.8.1 (A:254-412) FKBP51, C-terminal domain {Human (Homo sapiens)}
keswemdtkekleqaaivkekgtvyfkggkymqaviqygkivswlemeyglsekeskase
sfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakgd
fekvlevnaarlqismcqkkakehnerdrriyanm

SCOP Domain Coordinates for d1kt0a1:

Click to download the PDB-style file with coordinates for d1kt0a1.
(The format of our PDB-style files is described here.)

Timeline for d1kt0a1: