Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (15 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein ClpA, an Hsp100 chaperone, AAA+ modules [82421] (1 species) duplication: two AAA+ modules; the first module is structuraly similar to the CDC6 module whereas the second module to the HslU module |
Species Escherichia coli [TaxId:562] [82422] (1 PDB entry) |
Domain d1ksfx3: 1ksf X:437-755 [77524] Other proteins in same PDB: d1ksfx1 complexed with adp, ioh, met, mg, pge; mutant |
PDB Entry: 1ksf (more details), 2.6 Å
SCOP Domain Sequences for d1ksfx3:
Sequence, based on SEQRES records: (download)
>d1ksfx3 c.37.1.20 (X:437-755) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli} peksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagp tgvgktevtvqlskalgiellrfdmseymerhtvsrligappgyvgfdqgglltdavikh phavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvreterks iglihqdnstdameeikkiftpefrnrldniiwfdhlstdvihqvvdkfivelqvqldqk gvslevsqearnwlaekgydramgarpmarviqdnlkkplanellfgslvdggqvtvald kekneltygfqsaqkhkae
>d1ksfx3 c.37.1.20 (X:437-755) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli} peksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagp tgvgktevtvqlskalgiellrfdmseymerhtvsrligappgyvgfdqgglltdavikh phavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvrnstdam eeikkiftpefrnrldniiwfdhlstdvihqvvdkfivelqvqldqkgvslevsqearnw laekgydramgarpmarviqdnlkkplanellfgslvdggqvtvaldkekneltygfqsa qkhkae
Timeline for d1ksfx3: