![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein ClpA, an Hsp100 chaperone, AAA+ modules [82421] (1 species) duplication: two AAA+ modules; the first module is structurally similar to the CDC6 module whereas the second module to the HslU module |
![]() | Species Escherichia coli [TaxId:562] [82422] (2 PDB entries) Uniprot Q83LR6 |
![]() | Domain d1ksfx2: 1ksf X:168-436 [77523] Other proteins in same PDB: d1ksfx1 complexed with adp, ipa, met, mg, pge |
PDB Entry: 1ksf (more details), 2.6 Å
SCOPe Domain Sequences for d1ksfx2:
Sequence, based on SEQRES records: (download)
>d1ksfx2 c.37.1.20 (X:168-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} rlenfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegl awrivqgdvpevmadctiysldigsllagtkyrgdfekrfkallkqleqdtnsilfidei htiigagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkidit epsieetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideaga rarlmpvskrkktvnvadiesvvariari
>d1ksfx2 c.37.1.20 (X:168-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} rlenfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegl awrivqgdvpevmadctiysldigagtkyrgdfekrfkallkqleqdtnsilfideihti igagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkiditeps ieetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagarar lmpvskrkktvnvadiesvvariari
Timeline for d1ksfx2: