Lineage for d1ksfx2 (1ksf X:168-436)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479092Protein ClpA, an Hsp100 chaperone, AAA+ modules [82421] (1 species)
    duplication: two AAA+ modules; the first module is structurally similar to the CDC6 module whereas the second module to the HslU module
  7. 2479093Species Escherichia coli [TaxId:562] [82422] (2 PDB entries)
    Uniprot Q83LR6
  8. 2479096Domain d1ksfx2: 1ksf X:168-436 [77523]
    Other proteins in same PDB: d1ksfx1
    complexed with adp, ipa, met, mg, pge

Details for d1ksfx2

PDB Entry: 1ksf (more details), 2.6 Å

PDB Description: crystal structure of clpa, an hsp100 chaperone and regulator of clpap protease: structural basis of differences in function of the two aaa+ atpase domains
PDB Compounds: (X:) ATP-dependent clp protease ATP-binding subunit clpa

SCOPe Domain Sequences for d1ksfx2:

Sequence, based on SEQRES records: (download)

>d1ksfx2 c.37.1.20 (X:168-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}
rlenfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegl
awrivqgdvpevmadctiysldigsllagtkyrgdfekrfkallkqleqdtnsilfidei
htiigagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkidit
epsieetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideaga
rarlmpvskrkktvnvadiesvvariari

Sequence, based on observed residues (ATOM records): (download)

>d1ksfx2 c.37.1.20 (X:168-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}
rlenfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegl
awrivqgdvpevmadctiysldigagtkyrgdfekrfkallkqleqdtnsilfideihti
igagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkiditeps
ieetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagarar
lmpvskrkktvnvadiesvvariari

SCOPe Domain Coordinates for d1ksfx2:

Click to download the PDB-style file with coordinates for d1ksfx2.
(The format of our PDB-style files is described here.)

Timeline for d1ksfx2: