Lineage for d1ksda_ (1ksd A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216372Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 216373Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (5 families) (S)
  5. 216385Family a.102.1.2: Cellulases catalytic domain [48213] (6 proteins)
  6. 216394Protein Endo-b-1,4-glucanase [81848] (1 species)
  7. 216395Species Termite (Nasutitermes takasagoensis) [TaxId:62960] [81849] (3 PDB entries)
  8. 216398Domain d1ksda_: 1ksd A: [77521]
    complexed with ca

Details for d1ksda_

PDB Entry: 1ksd (more details), 1.6 Å

PDB Description: The structure of Endoglucanase from termite, Nasutitermes takasagoensis, at pH 6.5.

SCOP Domain Sequences for d1ksda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksda_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis)}
maydykqvlrdsllfyeaqrsgrlpadqkvtwrkdsalndqgdqgqdltggyfdagdfvk
fgfpmaytatvlawglidfeagyssagalddgrkavkwatdyfikahtsqnefygqvgqg
dadhafwgrpedmtmarpaykidtsrpgsdlagetaaalaaasivfrnvdgtysnnllth
arqlfdfannyrgkysdsitdarnfyasadyrdelvwaaawlyratndntylntaeslyd
efglqnwggglnwdskvsgvqvllakltnkqaykdtvqsyvnylinnqqktpkgllyidm
wgtlrhaanaafimleaaelglsassyrqfaqtqidyalgdggrsfvcgfgsnpptrphh
rssscppapatcdwntfnspdpnyhvlsgalvggpdqndnyvddrsdyvhnevatdynag
fqsalaalvalgy

SCOP Domain Coordinates for d1ksda_:

Click to download the PDB-style file with coordinates for d1ksda_.
(The format of our PDB-style files is described here.)

Timeline for d1ksda_: