Lineage for d1ksda1 (1ksd A:2-433)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004107Protein Endo-b-1,4-glucanase [81848] (1 species)
  7. 2004108Species Termite (Nasutitermes takasagoensis) [TaxId:62960] [81849] (3 PDB entries)
  8. 2004111Domain d1ksda1: 1ksd A:2-433 [77521]
    Other proteins in same PDB: d1ksda2
    complexed with ca

Details for d1ksda1

PDB Entry: 1ksd (more details), 1.6 Å

PDB Description: The structure of Endoglucanase from termite, Nasutitermes takasagoensis, at pH 6.5.
PDB Compounds: (A:) Endo-b-1,4-glucanase

SCOPe Domain Sequences for d1ksda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksda1 a.102.1.2 (A:2-433) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis) [TaxId: 62960]}
aydykqvlrdsllfyeaqrsgrlpadqkvtwrkdsalndqgdqgqdltggyfdagdfvkf
gfpmaytatvlawglidfeagyssagalddgrkavkwatdyfikahtsqnefygqvgqgd
adhafwgrpedmtmarpaykidtsrpgsdlagetaaalaaasivfrnvdgtysnnlltha
rqlfdfannyrgkysdsitdarnfyasadyrdelvwaaawlyratndntylntaeslyde
fglqnwggglnwdskvsgvqvllakltnkqaykdtvqsyvnylinnqqktpkgllyidmw
gtlrhaanaafimleaaelglsassyrqfaqtqidyalgdggrsfvcgfgsnpptrphhr
ssscppapatcdwntfnspdpnyhvlsgalvggpdqndnyvddrsdyvhnevatdynagf
qsalaalvalgy

SCOPe Domain Coordinates for d1ksda1:

Click to download the PDB-style file with coordinates for d1ksda1.
(The format of our PDB-style files is described here.)

Timeline for d1ksda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ksda2