Lineage for d1ks8a_ (1ks8 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358916Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 358917Superfamily a.102.1: Six-hairpin glycosidases [48208] (6 families) (S)
  5. 358929Family a.102.1.2: Cellulases catalytic domain [48213] (8 proteins)
  6. 358947Protein Endo-b-1,4-glucanase [81848] (1 species)
  7. 358948Species Termite (Nasutitermes takasagoensis) [TaxId:62960] [81849] (3 PDB entries)
  8. 358949Domain d1ks8a_: 1ks8 A: [77519]
    complexed with so4

Details for d1ks8a_

PDB Entry: 1ks8 (more details), 1.4 Å

PDB Description: The structure of Endoglucanase from termite, Nasutitermes takasagoensis, at pH 2.5.

SCOP Domain Sequences for d1ks8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ks8a_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis)}
maydykqvlrdsllfyeaqrsgrlpadqkvtwrkdsalndqgdqgqdltggyfdagdfvk
fgfpmaytatvlawglidfeagyssagalddgrkavkwatdyfikahtsqnefygqvgqg
dadhafwgrpedmtmarpaykidtsrpgsdlagetaaalaaasivfrnvdgtysnnllth
arqlfdfannyrgkysdsitdarnfyasadyrdelvwaaawlyratndntylntaeslyd
efglqnwggglnwdskvsgvqvllakltnkqaykdtvqsyvnylinnqqktpkgllyidm
wgtlrhaanaafimleaaelglsassyrqfaqtqidyalgdggrsfvcgfgsnpptrphh
rssscppapatcdwntfnspdpnyhvlsgalvggpdqndnyvddrsdyvhnevatdynag
fqsalaalvalgy

SCOP Domain Coordinates for d1ks8a_:

Click to download the PDB-style file with coordinates for d1ks8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ks8a_: