Lineage for d1ks6a_ (1ks6 A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063160Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 1063161Species Chicken (Gallus gallus) [TaxId:9031] [82900] (1 PDB entry)
  8. 1063162Domain d1ks6a_: 1ks6 A: [77517]

Details for d1ks6a_

PDB Entry: 1ks6 (more details)

PDB Description: transforming growth factor beta type ii receptor ligand binding domain
PDB Compounds: (A:) transforming growth factor beta type II receptor

SCOPe Domain Sequences for d1ks6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ks6a_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Chicken (Gallus gallus) [TaxId: 9031]}
qlprlckfcdvkattcsnqdqctsncnitsiceknnevcaavwrrndenvtletichdpq
krlyghmlddssseqcvmkekkddgglmfmcsctgeecndvlifsai

SCOPe Domain Coordinates for d1ks6a_:

Click to download the PDB-style file with coordinates for d1ks6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ks6a_: