SCOP 1.75: Domain d1kr3b_: 1kr3 B:

Lineage for d1kr3b_ (1kr3 B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)

6. Protein Zn metallo-beta-lactamase [56283] (10 species)

7. Species Bacteroides fragilis [TaxId:817] [56285] (9 PDB entries)

8. Domain d1kr3b_: 1kr3 B: [77511]
   complexed with 113, na, zn

Details for d1kr3b_

PDB Entry: 1kr3, 2.5 Å

PDB Description: crystal structure of the metallo beta-lactamase from bacteroides fragilis (cfia) in complex with the tricyclic inhibitor sb-236050.

PDB Compounds: (B:) beta-lactamase, type II

SCOP Domain Sequences for d1kr3b_:

Sequence; same for both SEQRES and ATOM records:

>d1kr3b_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}
svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadvt
awpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiests

Timeline for d1kr3b_:

• d1kr3b_ first appeared in SCOP 1.63
  
• d1kr3b_ appears in SCOP 1.73
  
• d1kr3b_ appears in SCOPe 2.01
  
• d1kr3b_ appears in the current release, SCOPe 2.08