Lineage for d1kr3b_ (1kr3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996722Species Bacteroides fragilis [TaxId:817] [56285] (10 PDB entries)
  8. 2996740Domain d1kr3b_: 1kr3 B: [77511]
    complexed with 113, na, zn

Details for d1kr3b_

PDB Entry: 1kr3 (more details), 2.5 Å

PDB Description: crystal structure of the metallo beta-lactamase from bacteroides fragilis (cfia) in complex with the tricyclic inhibitor sb-236050.
PDB Compounds: (B:) beta-lactamase, type II

SCOPe Domain Sequences for d1kr3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr3b_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}
svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadvt
awpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiests

SCOPe Domain Coordinates for d1kr3b_:

Click to download the PDB-style file with coordinates for d1kr3b_.
(The format of our PDB-style files is described here.)

Timeline for d1kr3b_: