Lineage for d1kr3a_ (1kr3 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263779Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 263780Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 263781Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 263782Protein Zn metallo-beta-lactamase [56283] (5 species)
  7. 263792Species Bacteroides fragilis [56285] (9 PDB entries)
  8. 263803Domain d1kr3a_: 1kr3 A: [77510]

Details for d1kr3a_

PDB Entry: 1kr3 (more details), 2.5 Å

PDB Description: crystal structure of the metallo beta-lactamase from bacteroides fragilis (cfia) in complex with the tricyclic inhibitor sb-236050.

SCOP Domain Sequences for d1kr3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis}
svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadvt
awpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiests

SCOP Domain Coordinates for d1kr3a_:

Click to download the PDB-style file with coordinates for d1kr3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kr3a_: