Lineage for d1kqoe_ (1kqo E:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242043Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 242161Family c.26.1.3: Adenylyltransferase [52397] (3 protein domains)
  6. 242162Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (5 species)
  7. 242192Species Human (Homo sapiens) [TaxId:9606] [75163] (5 PDB entries)
  8. 242209Domain d1kqoe_: 1kqo E: [77502]

Details for d1kqoe_

PDB Entry: 1kqo (more details), 2.5 Å

PDB Description: Crystal structure of NMN/NaMN adenylyltransferase complexed with deamido-NAD

SCOP Domain Sequences for d1kqoe_:

Sequence, based on SEQRES records: (download)

>d1kqoe_ c.26.1.3 (E:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens)}
ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptlerpg
rkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivanygli
cvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylvpdlv
qeyiekhnlyssesedrnagvilaplqrnta

Sequence, based on observed residues (ATOM records): (download)

>d1kqoe_ c.26.1.3 (E:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens)}
ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadlles
favpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandis
stkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta

SCOP Domain Coordinates for d1kqoe_:

Click to download the PDB-style file with coordinates for d1kqoe_.
(The format of our PDB-style files is described here.)

Timeline for d1kqoe_: