Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species) |
Species Human (Homo sapiens) [TaxId:9606] [75163] (6 PDB entries) |
Domain d1kqoe_: 1kqo E: [77502] complexed with dnd has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1kqo (more details), 2.5 Å
SCOPe Domain Sequences for d1kqoe_:
Sequence, based on SEQRES records: (download)
>d1kqoe_ c.26.1.3 (E:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptlerpg rkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivanygli cvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylvpdlv qeyiekhnlyssesedrnagvilaplqrnta
>d1kqoe_ c.26.1.3 (E:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadlles favpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandis stkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
Timeline for d1kqoe_: