Lineage for d1kqob_ (1kqo B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2442798Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2442830Species Human (Homo sapiens) [TaxId:9606] [75163] (6 PDB entries)
  8. 2442844Domain d1kqob_: 1kqo B: [77499]
    complexed with dnd

Details for d1kqob_

PDB Entry: 1kqo (more details), 2.5 Å

PDB Description: Crystal structure of NMN/NaMN adenylyltransferase complexed with deamido-NAD
PDB Compounds: (B:) nicotinamide mononucleotide adenylyl transferase

SCOPe Domain Sequences for d1kqob_:

Sequence, based on SEQRES records: (download)

>d1kqob_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptlerpg
rkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivanygli
cvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylvpdlv
qeyiekhnlyssesedrnagvilaplqrnta

Sequence, based on observed residues (ATOM records): (download)

>d1kqob_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadlles
favpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandis
stkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta

SCOPe Domain Coordinates for d1kqob_:

Click to download the PDB-style file with coordinates for d1kqob_.
(The format of our PDB-style files is described here.)

Timeline for d1kqob_: