Lineage for d1kqnd_ (1kqn D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105663Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2105692Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2105724Species Human (Homo sapiens) [TaxId:9606] [75163] (6 PDB entries)
  8. 2105728Domain d1kqnd_: 1kqn D: [77495]
    complexed with nad, xe

Details for d1kqnd_

PDB Entry: 1kqn (more details), 2.2 Å

PDB Description: Crystal structure of NMN/NaMN adenylyltransferase complexed with NAD
PDB Compounds: (D:) nicotinamide mononucleotide adenylyl transferase

SCOPe Domain Sequences for d1kqnd_:

Sequence, based on SEQRES records: (download)

>d1kqnd_ c.26.1.3 (D:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
rvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptlerpgr
krkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivanyglic
vtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylvpdlvq
eyiekhnlyssesedrnagvilaplqrnta

Sequence, based on observed residues (ATOM records): (download)

>d1kqnd_ c.26.1.3 (D:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
rvimaelatknskwvevdtweslqkewketlkvlrhhqekleavpkvkllcgadllesfa
vpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisst
kirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta

SCOPe Domain Coordinates for d1kqnd_:

Click to download the PDB-style file with coordinates for d1kqnd_.
(The format of our PDB-style files is described here.)

Timeline for d1kqnd_: