Lineage for d1kqma1 (1kqm A:29-76)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227771Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 227772Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 227773Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 227774Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (8 PDB entries)
  8. 227779Domain d1kqma1: 1kqm A:29-76 [77488]
    Other proteins in same PDB: d1kqma2, d1kqmb_, d1kqmc_
    complexed with anp, ca, mg

Details for d1kqma1

PDB Entry: 1kqm (more details), 3 Å

PDB Description: scallop myosin s1-amppnp in the actin-detached conformation

SCOP Domain Sequences for d1kqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqma1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOP Domain Coordinates for d1kqma1:

Click to download the PDB-style file with coordinates for d1kqma1.
(The format of our PDB-style files is described here.)

Timeline for d1kqma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kqma2