| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries) |
| Domain d1kpra2: 1kpr A:1-181 [77481] Other proteins in same PDB: d1kpra1, d1kprb_, d1kprc1, d1kprd_ complexed with so4 |
PDB Entry: 1kpr (more details), 2.8 Å
SCOPe Domain Sequences for d1kpra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpra2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h
Timeline for d1kpra2:
View in 3DDomains from other chains: (mouse over for more information) d1kprb_, d1kprc1, d1kprc2, d1kprd_ |