Lineage for d1kpra2 (1kpr A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600370Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (3 PDB entries)
  8. 600373Domain d1kpra2: 1kpr A:1-181 [77481]
    Other proteins in same PDB: d1kpra1, d1kprb_, d1kprc1, d1kprd_

Details for d1kpra2

PDB Entry: 1kpr (more details), 2.8 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E

SCOP Domain Sequences for d1kpra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpra2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

SCOP Domain Coordinates for d1kpra2:

Click to download the PDB-style file with coordinates for d1kpra2.
(The format of our PDB-style files is described here.)

Timeline for d1kpra2: