Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species) |
Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (3 PDB entries) |
Domain d1kpra2: 1kpr A:1-181 [77481] Other proteins in same PDB: d1kpra1, d1kprb_, d1kprc1, d1kprd_ |
PDB Entry: 1kpr (more details), 2.8 Å
SCOP Domain Sequences for d1kpra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpra2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E} gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll h
Timeline for d1kpra2:
View in 3D Domains from other chains: (mouse over for more information) d1kprb_, d1kprc1, d1kprc2, d1kprd_ |