Lineage for d1kpra2 (1kpr A:1-181)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255238Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 255325Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (3 PDB entries)
  8. 255328Domain d1kpra2: 1kpr A:1-181 [77481]
    Other proteins in same PDB: d1kpra1, d1kprb_, d1kprc1, d1kprd_

Details for d1kpra2

PDB Entry: 1kpr (more details), 2.8 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e

SCOP Domain Sequences for d1kpra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpra2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

SCOP Domain Coordinates for d1kpra2:

Click to download the PDB-style file with coordinates for d1kpra2.
(The format of our PDB-style files is described here.)

Timeline for d1kpra2: