SCOPe 2.08: Domain d1kpra2: 1kpr A:1-181

Lineage for d1kpra2 (1kpr A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)

8. Domain d1kpra2: 1kpr A:1-181 [77481]
   Other proteins in same PDB: d1kpra1, d1kprb1, d1kprb2, d1kprc1, d1kprd1, d1kprd2
   complexed with so4

Details for d1kpra2

PDB Entry: 1kpr, 2.8 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e

PDB Compounds: (A:) hla class I histocompatibility antigen, alpha chain

SCOPe Domain Sequences for d1kpra2:

Sequence; same for both SEQRES and ATOM records:

>d1kpra2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

Timeline for d1kpra2:

• d1kpra2 first appeared in SCOP 1.63
  
• d1kpra2 appears in SCOPe 2.07