SCOP 1.63: Domain d1kpra1: 1kpr A:182-274

Lineage for d1kpra1 (1kpr A:182-274)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [48957] (3 PDB entries)

8. Domain d1kpra1: 1kpr A:182-274 [77480]
   Other proteins in same PDB: d1kpra2, d1kprc2

Details for d1kpra1

PDB Entry: 1kpr, 2.8 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e

SCOP Domain Sequences for d1kpra1:

Sequence; same for both SEQRES and ATOM records:

>d1kpra1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-E}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqaytchvqheglpepvtlrw

Timeline for d1kpra1:

• d1kpra1 is new in SCOP 1.63
  
• d1kpra1 appears in SCOP 1.65
  
• d1kpra1 appears in the current release, SCOPe 2.08